Pages: 1 2 3 4 5 ... 304 305 306
admin addedadmin added
  • Views: 40
  • Duration: 1
  • Added: 2014-03-04
3535
  • Views: 247
  • Duration: 15:42
  • Added: 2014-03-04
admin addedadmin added
  • Views: 1
  • Duration: 1
  • Added: 2014-03-04
WBW-84300WBW-84300
  • Views: 5
  • Duration: 2:32
  • Added: 2013-07-14
best unseen cams (4)best unseen cams (4)
  • Views: 18
  • Duration: 1:08
  • Added: 2012-12-30
beauty on beauty 1 (new)beauty on beauty 1 (new)
  • Views: 1
  • Duration: 3:00
  • Added: 2013-09-13
1 (152) (new)1 (152) (new)
  • Views: 171
  • Duration: 3:38
  • Added: 2013-02-04
6767
  • Views: 122
  • Duration: 13:59
  • Added: 2013-07-14
1616
  • Views: 0
  • Duration: 1:43
  • Added: 2013-03-18
amateur teens (37)amateur teens (37)
  • Views: 0
  • Duration: 36:26
  • Added: 2013-04-09
2929
  • Views: 13
  • Duration: 3:00
  • Added: 2013-08-26
Most excellent xxx teens..Most excellent xxx teens (79)
  • Views: 0
  • Duration: 6:16
  • Added: 2013-03-17
Sexy Girl masterbates on..Sexy Girl masterbates on her bed
  • Views: 4
  • Duration: 1:14
  • Added: 2013-03-13
Hard toying in both HolesHard toying in both Holes
  • Views: 0
  • Duration: 4:04
  • Added: 2013-02-27
Horniest and very thin..Horniest and very thin 19yo Teen slut on Webcam
  • Views: 111
  • Duration: 6:28
  • Added: 2013-10-28
Digitalhotties-moviescom 739Digitalhotties-moviescom 739
  • Views: 0
  • Duration: 1
  • Added: 2013-07-14
1 (146) (new)1 (146) (new)
  • Views: 112
  • Duration: 1:31
  • Added: 2013-07-14
Mom dau playing on cam for..Mom dau playing on cam for daddy
  • Views: 30
  • Duration: 1:30
  • Added: 2013-07-14
Slender Guy Gets Fucked..Slender Guy Gets Fucked Corpulent Girlfriend
  • Views: 0
  • Duration: 5:09
  • Added: 2013-05-22
144144
  • Views: 0
  • Duration: 5:03
  • Added: 2013-10-07
admin addedadmin added
  • Views: 0
  • Duration: 1
  • Added: 2014-03-04
0101
  • Views: 0
  • Duration: 1:46
  • Added: 2013-02-26
teen pussy have fun on cam..teen pussy have fun on cam (11)
  • Views: 0
  • Duration: 3:35
  • Added: 2013-07-14
Anal Mix NinaAnal Mix Nina
  • Views: 0
  • Duration: 2:20
  • Added: 2012-12-27
xxx teens camxxx teens cam
  • Views: 0
  • Duration: 1:23
  • Added: 2013-01-09
Hot girl on webcam playHot girl on webcam play
  • Views: 0
  • Duration: 3:41
  • Added: 2013-07-09
Cute girl undresses all..Cute girl undresses all she got
  • Views: 112
  • Duration: 3:54
  • Added: 2013-11-15
147147
  • Views: 0
  • Duration: 2:05
  • Added: 2013-07-12
Hot Teen Gives Blowjob,..Hot Teen Gives Blowjob, Handjob and Swallows
  • Views: 0
  • Duration: 11:57
  • Added: 2013-07-14
Blonde amateur receives a..Blonde amateur receives a facial
  • Views: 0
  • Duration: 9:54
  • Added: 2013-07-14
1515
  • Views: 3
  • Duration: 6:53
  • Added: 2013-06-09
86328715838632871583
  • Views: 98
  • Duration: 1:22
  • Added: 2013-07-14
Teens on cam (12)Teens on cam (12)
  • Views: 5
  • Duration: 12:59
  • Added: 2013-01-05
teen pussy play on cam (7)teen pussy play on cam (7)
  • Views: 2
  • Duration: 1:06
  • Added: 2013-07-14
Legal age teenager Amateur..Legal age teenager Amateur (3)
  • Views: 72
  • Duration: 2:01
  • Added: 2013-08-08
sweet teensweet teen
  • Views: 55
  • Duration: 24:52
  • Added: 2014-01-11
sexy model shows bodysexy model shows body
  • Views: 32
  • Duration: 8:52
  • Added: 2014-01-02
Young Teen Girl with Puffy..Young Teen Girl with Puffy Tits (J65)
  • Views: 33
  • Duration: 12:18
  • Added: 2013-02-15
admin addedadmin added
  • Views: 8
  • Duration: 1
  • Added: 2014-03-04
Kurdish mature fucked by a..Kurdish mature fucked by a younger
  • Views: 0
  • Duration: 2:54
  • Added: 2013-07-14
18Yo Teens Cam Fun x012818Yo Teens Cam Fun x0128
  • Views: 6
  • Duration: 4:35
  • Added: 2013-07-14
Teens Stalked and UpskirtedTeens Stalked and Upskirted
  • Views: 58
  • Duration: 1:32
  • Added: 2013-06-29
Crowd of naked people race..Crowd of naked people race outside at Rokskilde fe
  • Views: 0
  • Duration: 2:32
  • Added: 2014-02-25
137F87E137F87E
  • Views: 11
  • Duration: 3:12
  • Added: 2012-12-27
superlatively good of 0050superlatively good of 0050
  • Views: 62
  • Duration: 4:12
  • Added: 2013-07-14
Legal age teenagers on cam..Legal age teenagers on cam 14
  • Views: 0
  • Duration: 2:01
  • Added: 2013-07-14
Sequence 03Sequence 03
  • Views: 1
  • Duration: 5:01
  • Added: 2013-07-14
Teen Muslim Girl Fucked at..Teen Muslim Girl Fucked at Web camera
  • Views: 0
  • Duration: 8:35
  • Added: 2012-12-24
5353
  • Views: 7
  • Duration: 6:59
  • Added: 2014-03-03
Fucking Friends Mommy On BedFucking Friends Mommy On Bed
  • Views: 6
  • Duration: 6:56
  • Added: 2014-02-19
kammypregfingeringkammypregfingering
  • Views: 0
  • Duration: 4:35
  • Added: 2014-01-02
Video - I Hope U Like ItVideo - I Hope U Like It
  • Views: 69
  • Duration: 3:14
  • Added: 2013-09-04
admin addedadmin added
  • Views: 14
  • Duration: 1
  • Added: 2012-10-14
admin addedadmin added
  • Views: 60
  • Duration: 1
  • Added: 2012-10-14
two fingersin your ass sweettwo fingersin your ass sweet
  • Views: 6
  • Duration: 13:04
  • Added: 2013-06-21
CFNM car blowjob by couple..CFNM car blowjob by couple in parking lot
  • Views: 4
  • Duration: 9:27
  • Added: 2013-07-14
TEEN - 7TEEN - 7
  • Views: 52
  • Duration: 18:57
  • Added: 2013-12-24
Amateur teen bawdy cleft (2)Amateur teen bawdy cleft (2)
  • Views: 8
  • Duration: 4:07
  • Added: 2013-09-10
Hot teen riding sex machineHot teen riding sex machine
  • Views: 23
  • Duration: 8:10
  • Added: 2013-06-10
admin addedadmin added
  • Views: 7
  • Duration: 1
  • Added: 2014-03-04
Youthful princess (6)Youthful princess (6)
  • Views: 45
  • Duration: 3:35
  • Added: 2014-03-04
teens 0256teens 0256
  • Views: 32
  • Duration: 4:23
  • Added: 2013-07-14
admin addedadmin added
  • Views: 32
  • Duration: 1
  • Added: 2012-10-14
garage strip teasegarage strip tease
  • Views: 13
  • Duration: 1:47
  • Added: 2013-07-14
TheBestMasturbation (new)TheBestMasturbation (new)
  • Views: 3
  • Duration: 11:17
  • Added: 2013-12-21
in your ass babyin your ass baby
  • Views: 12
  • Duration: 1:15
  • Added: 2012-12-11
teen3teen3
  • Views: 39
  • Duration: 10:38
  • Added: 2013-07-14
pov-blowjob-and-fuck-videopov-blowjob-and-fuck-video
  • Views: 40
  • Duration: 10:37
  • Added: 2013-07-14
admin addedadmin added
  • Views: 39
  • Duration: 1
  • Added: 2014-03-04
Jasan 27 Sweden capsJasan 27 Sweden caps
  • Views: 11
  • Duration: 10:49
  • Added: 2013-07-24
1 (127) (new)1 (127) (new)
  • Views: 41
  • Duration: 20
  • Added: 2013-07-14
teen1384teen1384
  • Views: 18
  • Duration: 41:58
  • Added: 2013-10-01
hushx05084hushx05084
  • Views: 39
  • Duration: 16:33
  • Added: 2012-12-23
worthwhile amateur jizz..worthwhile amateur jizz flow compilation
  • Views: 37
  • Duration: 5:14
  • Added: 2013-01-14
42544254
  • Views: 36
  • Duration: 4:46
  • Added: 2014-03-04
croatian bushy girlcroatian bushy girl
  • Views: 28
  • Duration: 10:54
  • Added: 2013-08-26
Teen plays (3) (new)Teen plays (3) (new)
  • Views: 36
  • Duration: 6:26
  • Added: 2013-08-17
exgf edible goodsq(5-30)exgf edible goodsq(5-30)
  • Views: 7
  • Duration: 12:39
  • Added: 2012-05-30
6767
  • Views: 2
  • Duration: 5:53
  • Added: 2013-07-14
Msn love girls spunk..Msn love girls spunk fountain
  • Views: 11
  • Duration: 3:02
  • Added: 2013-07-14
admin addedadmin added
  • Views: 1
  • Duration: 1
  • Added: 2014-03-04
youngbabes00912youngbabes00912
  • Views: 25
  • Duration: 2:39
  • Added: 2013-10-22
admin addedadmin added
  • Views: 34
  • Duration: 1
  • Added: 2014-03-04
2020
  • Views: 7
  • Duration: 5:31
  • Added: 2013-07-21
nudist hotty filmed at..nudist hotty filmed at beach (2)
  • Views: 14
  • Duration: 14
  • Added: 2013-07-14
Legal age teenager Couple..Legal age teenager Couple Doggystyle Sex
  • Views: 28
  • Duration: 7:27
  • Added: 2014-01-14
111111
  • Views: 34
  • Duration: 6:27
  • Added: 2013-01-10
18Yo Teens Web camera Fun..18Yo Teens Web camera Fun x0127
  • Views: 13
  • Duration: 3:23
  • Added: 2013-07-14
Amateur teen muff (137)Amateur teen muff (137)
  • Views: 32
  • Duration: 5:08
  • Added: 2013-09-28
Indian Model Poonam Pandey..Indian Model Poonam Pandey Holi 2012 Hot Video
  • Views: 32
  • Duration: 2:55
  • Added: 2012-12-25
admin addedadmin added
  • Views: 9
  • Duration: 1
  • Added: 2012-10-14
admin addedadmin added
  • Views: 33
  • Duration: 1
  • Added: 2014-03-04
Stickam Webcam Cuties (1718)Stickam Webcam Cuties (1718)
  • Views: 13
  • Duration: 9:56
  • Added: 2014-03-04
admin addedadmin added
  • Views: 8
  • Duration: 1
  • Added: 2014-03-04
legal age teenager show..legal age teenager show  webcam
  • Views: 3
  • Duration: 3:20
  • Added: 2013-11-18
homemadeClips (13)homemadeClips (13)
  • Views: 15
  • Duration: 0:57
  • Added: 2013-07-14
Webcam Amateur Teen 001 (27)Webcam Amateur Teen 001 (27)
  • Views: 13
  • Duration: 4:55
  • Added: 2013-07-14
Laidcam hawt show! (10)Laidcam hawt show! (10)
  • Views: 1
  • Duration: 5:43
  • Added: 2012-12-30
1818
  • Views: 23
  • Duration: 14:53
  • Added: 2014-03-04
so pretty teen (3)so pretty teen (3)
  • Views: 25
  • Duration: 9:23
  • Added: 2013-07-14
best of 0067best of 0067
  • Views: 10
  • Duration: 3:19
  • Added: 2013-07-14
001001
  • Views: 31
  • Duration: 5:12
  • Added: 2013-06-24
bates (1)bates (1)
  • Views: 14
  • Duration: 29:24
  • Added: 2013-07-14
Brunette Legal age..Brunette Legal age teenager Fucking Blowjob Spycam
  • Views: 22
  • Duration: 22:25
  • Added: 2013-01-30
Dilettante legal age..Dilettante legal age teenager pussy (262)
  • Views: 6
  • Duration: 4:18
  • Added: 2013-10-10
admin addedadmin added
  • Views: 9
  • Duration: 1
  • Added: 2012-10-14
British escort fucked in..British escort fucked in Birmingham
  • Views: 13
  • Duration: 15:19
  • Added: 2013-07-14
Isteri CurangIsteri Curang
  • Views: 30
  • Duration: 11:34
  • Added: 2014-03-04
ama Teenies (39)ama Teenies (39)
  • Views: 8
  • Duration: 5:56
  • Added: 2013-10-10
Horniest Amateur Desi Teen..Horniest Amateur Desi Teen shows sucking dick pote
  • Views: 8
  • Duration: 6:10
  • Added: 2014-01-17
Horniest Amateur COllege..Horniest Amateur COllege Legal age teenager ddoing office work o
  • Views: 17
  • Duration: 7:17
  • Added: 2014-01-29
teen videos (98)teen videos (98)
  • Views: 15
  • Duration: 11:33
  • Added: 2013-01-17
Amateur sex TEEN Video aaa16Amateur sex TEEN Video aaa16
  • Views: 15
  • Duration: 3:00
  • Added: 2013-07-14
Web camera Teen Hotty (7)Web camera Teen Hotty  (7)
  • Views: 15
  • Duration: 4:29
  • Added: 2013-10-10
Web cam legal age teenager..Web cam legal age teenager recent       (2)
  • Views: 16
  • Duration: 6:18
  • Added: 2014-03-04
Free teens 0128Free teens  0128
  • Views: 16
  • Duration: 3:38
  • Added: 2014-03-04
arab street fuckarab street fuck
  • Views: 16
  • Duration: 6:56
  • Added: 2013-07-14
legal age teenager pussy..legal age teenager pussy play on cam (26)
  • Views: 16
  • Duration: 8:49
  • Added: 2013-03-14
14137694001413769400
  • Views: 16
  • Duration: 1:00
  • Added: 2013-07-14
Young couple oral jobYoung couple oral job
  • Views: 17
  • Duration: 16:37
  • Added: 2013-05-10
119119
  • Views: 17
  • Duration: 15:22
  • Added: 2013-07-14
admin addedadmin added
  • Views: 17
  • Duration: 1
  • Added: 2014-03-04
young teens amate 00155young teens amate 00155
  • Views: 18
  • Duration: 3:00
  • Added: 2014-03-04
Teen amateurs livecam !Teen amateurs livecam  !
  • Views: 18
  • Duration: 11:43
  • Added: 2013-07-14
Couple Making Homemade PornCouple Making Homemade Porn
  • Views: 19
  • Duration: 17:36
  • Added: 2013-04-09
Young WildYoung Wild
  • Views: 19
  • Duration: 6:40
  • Added: 2013-07-14
admin addedadmin added
  • Views: 19
  • Duration: 1
  • Added: 2014-03-04
Indian Girl Having Sex..Indian Girl Having Sex With Neighbour
  • Views: 20
  • Duration: 2:17
  • Added: 2012-12-25
New Webcam Girls Have fun..New Webcam Girls Have fun  (27)
  • Views: 20
  • Duration: 3:42
  • Added: 2013-07-14
webcam teens 005webcam teens 005
  • Views: 20
  • Duration: 4:56
  • Added: 2013-07-14
Xanyvids Live Webcam..Xanyvids Live Webcam Show005 Nov 19 2321
  • Views: 20
  • Duration: 3:33
  • Added: 2013-07-14
Amateur Brazilian Teen..Amateur Brazilian Teen Fucked
  • Views: 21
  • Duration: 19:59
  • Added: 2012-12-29
Girl BatesGirl Bates
  • Views: 21
  • Duration: 6:12
  • Added: 2013-02-16
Mature Wife Gets Drilled..Mature Wife Gets Drilled Missionary Hard In Lingeri
  • Views: 21
  • Duration: 5:28
  • Added: 2013-07-14
lesbians-fingering-licking..lesbians-fingering-licking-ass
  • Views: 22
  • Duration: 28:27
  • Added: 2013-07-27
fresh cams 26fresh cams 26
  • Views: 23
  • Duration: 2:05
  • Added: 2013-07-14
1 (269) (new)1 (269) (new)
  • Views: 24
  • Duration: 7:34
  • Added: 2013-03-17
Young GF receives her face..Young GF receives her face soiled - Free Porn Movies -
  • Views: 25
  • Duration: 3:33
  • Added: 2013-01-27
Video+-+young+++tightVideo+-+young+++tight
  • Views: 25
  • Duration: 3:53
  • Added: 2013-07-14
Cumming for tips! Cheerful..Cumming for tips! Cheerful chick
  • Views: 25
  • Duration: 5:16
  • Added: 2013-05-25
Teen with Big Round Boobs,..Teen with Big Round Boobs, This have u neeber se
  • Views: 26
  • Duration: 8:39
  • Added: 2013-03-15
Legal age teenager Girls..Legal age teenager Girls acquire Stripped on TubEvent (526)
  • Views: 26
  • Duration: 3:34
  • Added: 2014-03-04
More Legal age teenager..More Legal age teenager Cam Girls receive naked (125)
  • Views: 27
  • Duration: 3:34
  • Added: 2014-03-04
Hijab Masturbation Web..Hijab Masturbation Web camera
  • Views: 28
  • Duration: 5:05
  • Added: 2013-03-17
18yo teen Katalyn Take A..18yo teen  Katalyn Take A Shower And Masturbate
  • Views: 28
  • Duration: 2:20
  • Added: 2013-05-21
hh
  • Views: 28
  • Duration: 15:13
  • Added: 2013-05-25
teen on cams-teencom (22)teen on cams-teencom (22)
  • Views: 28
  • Duration: 10:46
  • Added: 2012-11-17
112112
  • Views: 28
  • Duration: 7:02
  • Added: 2013-07-14
50dc077433850wy5365d4u5ywy..50dc077433850wy5365d4u5ywy3654i65goi6f4i653cjhw
  • Views: 29
  • Duration: 11:14
  • Added: 2013-02-14
amateur legal age teenager..amateur legal age teenager porn
  • Views: 29
  • Duration: 5:00
  • Added: 2014-03-04